PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 885383
Common NameARALYDRAFT_684827
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 322aa    MW: 35316.5 Da    PI: 8.8884
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
885383genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1273117147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
           885383  73 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 117
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.68E-1667123IPR009057Homeodomain-like
PROSITE profilePS5129413.75868122IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-671123IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-1871120IPR006447Myb domain, plants
SMARTSM007179.6E-1072120IPR001005SANT/Myb domain
PfamPF002496.2E-1073117IPR001005SANT/Myb domain
CDDcd001671.34E-775118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MVSRNPNLSD GYFLDPTGMN VPGLGPSFTA AVSSSPTTSS TAVTVTDATA MVSSSEEDLS  60
KKIRKPYTIT KSRESWTEPE HDKFLEALQL FDRDWKKIEA FIGSKTVIQI RSHAQKYFLK  120
VQKSGTGEHL PPPRPKRKAA HPYPQKAHKN VQPQVPGSFK STSEPNDPSF MFRPESSSML  180
MTSPTTVADP WTNNAQTISF TPLPKAGAGA NNNCSSSSEN TPRPQSNRDA SDQGNVGHSL  240
RVLPDFAQVY GFIGSVFDPY ASNHLQKLKK MDPIDVETVL LLMRNLSINL SSPDFEDHRR  300
LLSSYDIGSE TATDRDGVNK P*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5503030.0AY550303.1 Arabidopsis thaliana MYB transcription factor (At5g52660) mRNA, complete cds.
GenBankBT0020020.0BT002002.1 Arabidopsis thaliana putative protein (At5g52660) mRNA, complete cds.
GenBankBT0258820.0BT025882.1 Arabidopsis thaliana At5g52660 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865926.10.0predicted protein
SwissprotQ8H0W30.0RVE6_ARATH; Protein REVEILLE 6
TrEMBLD7MS740.0D7MS74_ARALL; Predicted protein
STRINGAl_scaffold_0008_16470.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-177MYB_related family protein